Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00028.70
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family HD-ZIP
Protein Properties Length: 858aa    MW: 93867.2 Da    PI: 6.3688
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00028.70genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    ++k +++t++q++eLe +F+++++p++++r eL+++lgL+ +q+k+WFqNrR+++k
                    79999************************************************999 PP

          START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                    la++a++el+k a+ + p+W+ks     + + ++e++++f++  +     + +ea r++g+ + ++  lve+l+d++ qW e +     +a++++v
                    6899**********************9999**********99888999*99**************************.****************** PP

          START  85 issg.......galqlmv.aelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvt 165
                    issg       galq+m   ++  +splvp R + f+R+++q+ +g+w++vdvS+d +q+ +   ++  +++lpSg+++++++ng +kv+
                    ****************97258899************************************9997888888******************98 PP

          START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                    g  +vtwveh +++++++h+l+r +++sg  +ga++wvatlqr+ce+
                    4.58*****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.929115175IPR001356Homeobox domain
SMARTSM003893.7E-18117179IPR001356Homeobox domain
PfamPF000462.1E-18118173IPR001356Homeobox domain
CDDcd000864.66E-19118175No hitNo description
PROSITE patternPS000270150173IPR017970Homeobox, conserved site
PROSITE profilePS5084835.728313590IPR002913START domain
SuperFamilySSF559612.06E-23313502No hitNo description
CDDcd088751.76E-98317586No hitNo description
SMARTSM002344.1E-21322587IPR002913START domain
PfamPF018522.0E-29323507IPR002913START domain
PfamPF018523.5E-10537587IPR002913START domain
SuperFamilySSF559612.06E-23542587No hitNo description
SuperFamilySSF559616.32E-20615851No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 858 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090292.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A067JEK70.0A0A067JEK7_JATCU; Uncharacterized protein
STRINGPOPTR_0015s13340.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein